Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647826.1 | 5prime_partial | 250 | 1-753(+) |
Amino Acid sequence : | |||
GLSVSETNSIAIGREGGVAPLIELARSDVVDVHETAAGALWNLAFNPGNALRIVEEGGVPALVHLCSSSKSKMARFMAALALAYMFDGRMDEVASAGPSAEGVSKSMISLDGARRMALKH IEAFVLTFSDPQSFSAAAASSAPASLAQVAEAARIQEAGHLRCSGAEIGRFVFMLRNSSSILKSCAAFALLQFTIPGGRHAMHHASLLQNTGAPRVIRSAAAAATAPIEAKIFARIVLRN LEHHNGEASI* | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 11,730.211 | ||
Theoretical pI: | 5.273 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 49.958 | ||
aromaticity | 0.045 | ||
GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.261 | ||
sheet | 0.369 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647826.1 | complete | 111 | 584-249(-) |
Amino Acid sequence : | |||
MVNWRSANAAHDLSMEEEFRSMKTNLPISAPLHLRCPASCIRAASATCANEAGADDAAAAEKDWGSENVRTKASICFKAILLAPSKLIILFETPSAEGPADATSSILPSNI* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,730.211 | ||
Theoretical pI: | 5.273 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 49.958 | ||
aromaticity | 0.045 | ||
GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.261 | ||
sheet | 0.369 |