Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647840.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
NHKSRENSSSNSINNHHEEYPNALVDRRNVLLGLGAGLYGFAGLNAADRLAVGAPIMPPDLSKCGPADLPAGAKPTDCCPPENFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAV ALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPNLEIQVHNSWLFFPWHRYYLYFYERILGKLIDDPSFAIPYWNWDSPAGMVLPEFYADPKSPLYDSLRDAKHQP | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 25,569.620 | ||
Theoretical pI: | 5.962 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41620 | ||
Instability index: | 52.480 | ||
aromaticity | 0.118 | ||
GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.285 | ||
sheet | 0.250 |