Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647845.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
AASSSIATERLLQCLAVPSGPAIPVYTPNNSSYNSILQSKIQIVRFASSGIPKPRLIITPLHESHVQKAVICCRKHGFQMRTRSGGHDYEGLSYTTYNDIIPFVVLDLFNLQTISVDVED GTAWVQAGATLAQVYYKIADKTSTYGFPAGICPTVGVGGHFSGGGYGTLMRKYGLSADNIVDARIVNVDGKILNKDSMGEELFWAIRGGGGASFGIVLSWKIKLVPVPKTVTVFRIQRTL | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 25,926.544 | ||
Theoretical pI: | 9.264 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31650 | ||
Instability index: | 25.448 | ||
aromaticity | 0.092 | ||
GRAVY | 0.095 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.271 | ||
sheet | 0.183 |