Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647849.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
SYLAAPKAIDFSRRRATINSNSRLFSFALSSQSYKRIANSGFSRAKRRLSTRSMIVDVERSGAAAIEQESYDAIVIGSGIGGLVAATQLAVKGAKVLVLEKYVIPGGSSGYYQRDGFTFD VGSSIMFGFSDKGNLNLITQALAAVGCEMQVIPDPSTVHFHLPNDLSVRVHRGYDDFINELISRFPHEKDGINKFYSVCWKIFNALNSLELKSLEEPIYLFGQFF | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 24,856.004 | ||
Theoretical pI: | 9.035 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 40.862 | ||
aromaticity | 0.116 | ||
GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.271 | ||
sheet | 0.227 |