Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647865.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
PTFFNKTTSSPMAATVLLLGLLLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYI AVGNEVSPIREAQYVPFVLPAMRNIY | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,166.447 | ||
Theoretical pI: | 9.525 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 57.195 | ||
aromaticity | 0.082 | ||
GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.288 | ||
sheet | 0.233 |