Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647892.1 | complete | 263 | 45-836(+) |
Amino Acid sequence : | |||
MAVSSYCSRVFPPAFECRSDPDFSGNPRPEKASFGQFSYRKVPICGSVGGSGGLSSLIFRFPPNFVRQLSTKARRNCSNIGVAQVVAASWSNNNNSSSSSNNNNNNVPAVPNVVAAAAVD APAVIDLTNDEAASVDDGVYCNNSSGVVQFSGSAALKASFLRSDGSVAIHAGERLGRGIVTDGITTPVVNTTAYFFKTSDELIDFKEGRHASFEYGRYGNPTTVVAEEKISALEGAESTI FMASGMCASTVLLFALVPEVGIL* | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 27,604.483 | ||
Theoretical pI: | 5.460 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 31.217 | ||
aromaticity | 0.087 | ||
GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.342 | ||
sheet | 0.217 |