Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647896.1	3prime_partial	213	138-776(+)
Amino Acid sequence :
MSRKMLIDGEVSNAQEEAEKYDYDLFVIGAGSGGVRASRTAAGFGAKVAICELPFHPISSEVVGGVGGTCVIRGCVPKKILVYGASFSGELEDARNYGWELNEKIGLNWKKLLENKTQEI VRLNGIYKRLLSNAGVKMFEGEGKVIGPNEVELTQLDGTRMSFSAKHILIATGSRAHRPAIPGMELAITSDEALSLEELPKRAVVLGGGYIAV
Physicochemical properties
Number of amino acids:		213
Molecular weight:		11,400.745
Theoretical pI:		9.421
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		28.563
aromaticity		0.050
GRAVY		-0.474
Secondary Structure Fraction
Helix		0.267
turn		0.228
sheet		0.277

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647896.1	complete	102	199-507(+)
Amino Acid sequence :
MIMICSLLVPAVAVFVLPELQLDLELRLLFASFLFIQLAQKLLGELVEHVSFVAVYQKRFWYMEHLFQVNLRMLEIMAGSSMKKLVLTGKSFWRIRHKKLLD*
Physicochemical properties
Number of amino acids:		102
Molecular weight:		11,400.745
Theoretical pI:		9.421
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		28.563
aromaticity		0.050
GRAVY		-0.474
Secondary Structure Fraction
Helix		0.267
turn		0.228
sheet		0.277

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647896.1	3prime_partial	101	305-3(-)
Amino Acid sequence :
MKRKLANSNLSSKSSCSSGSTNTATAGTNNEQIIIILLRLFLSVADLTVDKHLSRHDYSTRDSSLIKVAGEQMIRVFFAFNGQLLRAARERERERERDDEI
Physicochemical properties
Number of amino acids:		101
Molecular weight:		11,400.745
Theoretical pI:		9.421
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		28.563
aromaticity		0.050
GRAVY		-0.474
Secondary Structure Fraction
Helix		0.267
turn		0.228
sheet		0.277