Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647902.1	internal	253	2-760(+)
Amino Acid sequence :
QWRSRVSAIGAAHFSAAAEPSTKNATPSSLRVQNLIGGEFVDSQATETIDVLNPATQEVVSRVPLTTSEEFKAAVTAAKEAFPSWRNTPITTRQRVMLKLQELIRRDADKLALNITTEQG KTLKDAHGDVFRGLEVVEHACGMATLQMGEFFSNVSGGIDTYSIREPLGVCSGICPFNFPAMIPLWMFPMAVTCGNTFVLKPSEKDPGASMILAELAMEAGLPSGVLNIVHGTHDVVNNI CDDDDIKAISFVG
Physicochemical properties
Number of amino acids:		253
Molecular weight:		13,346.224
Theoretical pI:		9.663
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		40.901
aromaticity		0.063
GRAVY		0.141
Secondary Structure Fraction
Helix		0.281
turn		0.375
sheet		0.172

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647902.1	complete	128	687-301(-)
Amino Acid sequence :
MFKTPLGNPASIASSASIIEAPGSFSDGFKTKVLPQVTAIGNIHSGIIAGKLKGQIPEQTPSGSRILYVSIPPDTLEKNSPICKVAIPQACSTTSSPRNTSPWASFNVFPCSVVIFRASL SASLRISS*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		13,346.224
Theoretical pI:		9.663
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		40.901
aromaticity		0.063
GRAVY		0.141
Secondary Structure Fraction
Helix		0.281
turn		0.375
sheet		0.172