Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647903.1	internal	272	1-816(+)
Amino Acid sequence :
PRSTIEIIRLAFASSTMYLTEDVLFPSLSPFRFSGKRSPVKNLDLVSRRFDEALLYRLKSLVSCTNPSRFSLSWLSLAVDLLSSTHADAEKIISEIRSSSGLDHALGLYLDDSVKLLDAC NSIISEIERLRQNRLLIHYALHLLEFSGADRDSPSIEKLSRARNSLSEWTTSPPESKKGDLRNPASLIRDLAIRLEDPPNGKISNAGKLIHRTIYTVGAVAVLVSGVVVAALAGSSSEII RVRVPSEFVWADAFNGLETAVAGEVKRLFGDE
Physicochemical properties
Number of amino acids:		272
Molecular weight:		14,267.824
Theoretical pI:		9.915
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		50.741
aromaticity		0.073
GRAVY		-0.957
Secondary Structure Fraction
Helix		0.228
turn		0.236
sheet		0.228

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647903.1	3prime_partial	123	371-3(-)
Amino Acid sequence :
MMELQASNSFTLSSRYRPSAWSKPDDDLISEMIFSASACVDDRRSTAKESQDKLNLLGFVHETRDLRRYSKASSNRRETRSRFLTGDRFPEKRKGEREGKRTSSVRYIVDEANAKRIISI VDR
Physicochemical properties
Number of amino acids:		123
Molecular weight:		14,267.824
Theoretical pI:		9.915
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		50.741
aromaticity		0.073
GRAVY		-0.957
Secondary Structure Fraction
Helix		0.228
turn		0.236
sheet		0.228