Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647911.1 | internal | 270 | 2-811(+) |
Amino Acid sequence : | |||
NSLHSLSSSAGESETMLSTTPTRSVIVSAIKTSTAFKSLPNGKSIHAHIIKSGYLPQTQLFNHLLNLYSKCSDFVSAHKVFDEMPDRNLVSFATLMSGYSRSDMPQFALSLVPDLQDHNL TPNQFVFSSLILACSKLKCFNSGEQIHTQVIVSGFESDPFVQASLVDMFSKFGDLESAVSVFGSNQCNDLVTYNSMISGYVSLSSYVEAFELFVEMHRTIYFGPTESTFGSVIKACSNLG IEYGDQIHCLCLKNGFVSHYFVGTSLVDMY | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 29,701.353 | ||
Theoretical pI: | 5.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 15275 | ||
Instability index: | 37.371 | ||
aromaticity | 0.111 | ||
GRAVY | 0.104 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.293 | ||
sheet | 0.215 |