Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647915.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
NYACLRALLLLLLLSGSVIQVLSLAVGINYGQIANNLPSPSRVAALLRSININRVKLYDADPNVLQAFSNTNVEFIVSVGNEYILNMTDLTKAQDWLKIHIQPYIPQTKITCITVGNEVL SGNDRQLMSNLLPAMQTMHSALVSLGWDKEVYVSTAHSLQILAYSFPPSSGLFRQDLGQYIQPLLNFHSQVNSPFLINAYPYFAYKDNPNEVSLDYVLFRPNQGLTDPNTNLNY | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 26,137.637 | ||
Theoretical pI: | 6.059 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 41.841 | ||
aromaticity | 0.098 | ||
GRAVY | 0.069 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.286 | ||
sheet | 0.252 |