Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647917.1 | 3prime_partial | 222 | 63-728(+) |
Amino Acid sequence : | |||
MSVTSIPAMGLLLLCCWAAMVDAEYMKYKDPKQPLNTRIKDLMARMTLEEKIGQMVQIERSVASADVMKKYFIGSVLSGGGSVPAPRASAETWIKMVNEFQRGSLSTRLGIPMIYGIDAV HGHNNVYNATIFPHNVGLGATRDPHLLKKIGAATALEVRATGIPYTFAPCIAVCRDPRWGRCYESYSEDPKIVQAMTDIIPGLQGDLPAGSRKGVPFVGGSK | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 24,117.892 | ||
Theoretical pI: | 9.082 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
Instability index: | 30.720 | ||
aromaticity | 0.072 | ||
GRAVY | -0.023 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.252 | ||
sheet | 0.257 |