Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647924.1 | complete | 208 | 108-734(+) |
Amino Acid sequence : | |||
MMSSPGSDLAGMNLKETELTLALPGESRCNNTEAEIAVGKITAGKRGFSETVDLNAESKYPADEQSETEVSSAGKAPASKAQVVGWPPVRSFRKNALKSCKYVKVAVDGAPYLRKVDLEM YGSYAELLSALGEMFTCFTIRNSCMSEGKLIDRVNGVEYMSTYEDKDGDWMLVGDVPWKMFVESCKRLRIMKSSDAIGLAPRTPVMKE* | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 22,790.896 | ||
Theoretical pI: | 5.493 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 53.597 | ||
aromaticity | 0.072 | ||
GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.255 | ||
sheet | 0.303 |