Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647931.1 | internal | 195 | 3-587(+) |
Amino Acid sequence : | |||
DTSKLKTFSIYRWNPENPSKPQLQDYQIDLKDCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNGLACLTKIDSAGGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEP WLKRKNAPPTPGKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHAHRWISDSRDEYTKER | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 20,146.575 | ||
Theoretical pI: | 11.686 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 57.374 | ||
aromaticity | 0.017 | ||
GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.176 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647931.1 | 5prime_partial | 176 | 587-57(-) |
Amino Acid sequence : | |||
TLLCVLIATVTNPPVSVKQRSRAKIRLRVPPVTRTRCTATSAQNTFIHPIQLRSILLTLRNLLPWRRRCVLPLQPRLNTLILIIKIRHVHNQILNHKHMRQRRDCTGTSSGRIDLRETRQ PVASVDVHRAGSTDPLAARSPKREGRIDLVLDLDKRVKDHRTTVLKVDLIVLELGF* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 20,146.575 | ||
Theoretical pI: | 11.686 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 57.374 | ||
aromaticity | 0.017 | ||
GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.176 | ||
sheet | 0.210 |