Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647941.1	internal	246	1-738(+)
Amino Acid sequence :
LESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNAAVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNE YNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAAYSELESTLSGVNVVIETYFADVPAEAYKTLTSLKG VTGFGF
Physicochemical properties
Number of amino acids:		246
Molecular weight:		26,925.097
Theoretical pI:		4.801
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		45380 45380
Instability index:		27.810
aromaticity		0.126
GRAVY		-0.021
Secondary Structure Fraction
Helix		0.337
turn		0.236
sheet		0.285