Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647947.1	internal	234	1-702(+)
Amino Acid sequence :
QSGNAETVSEQQKKDLVTSLPGVSFNVSFSHYAGYVNVNESSGRWLFYWFIEAAEDPSSKPLVIWLEGGPGCSGLAFGQAVQIGPFRVTPDGKTLRLNPYSWNQVANIIFLEFPVGTGFS YSTNPSDVLTNGDKRTAEDSLVFLLKWFERFPQYKGRDFYIVGESYAGHYVPQLAQAIVRYQQSKSDKSINLKGYMVGNPLIDDFNDHTGFSQFWWSLGFISDQTYKLYNALCI
Physicochemical properties
Number of amino acids:		234
Molecular weight:		26,328.154
Theoretical pI:		5.378
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		57870 57995
Instability index:		38.527
aromaticity		0.158
GRAVY		-0.252
Secondary Structure Fraction
Helix		0.359
turn		0.295
sheet		0.179