Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647956.1 | internal | 244 | 3-734(+) |
Amino Acid sequence : | |||
FLWVDCEQGYSSSTRRLARCRSSQCSLARANGCGTCTTPGCSNETCILAPDNTVTGTATSGELADDVVAVQSTDGSNPGSAVKVPRFLFSCAPTFLLRGLANGVNGMAGFGRTRIALPTQ FSASFSFQRKFAICLSSSTSERGVVFLGDGPYRLLPRFINEDLSKSLTYTPLFINPVSTASAFAQGEPSAEYFIGVKSITINDKAVAMNTALLSINKTDGYGGTKISTVDPYTVMETSIY KAFT | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 25,914.029 | ||
Theoretical pI: | 8.385 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16430 | ||
Instability index: | 24.497 | ||
aromaticity | 0.094 | ||
GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.295 | ||
sheet | 0.213 |