Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647957.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
ALNRQQVLLQHLRPSASLSQLGDESAISASICLAGDSSAYQRTSVFGDDVVIVAAYRTPICKSRRGGFKDTFADDLLAPVLKAVIEKTNVDPSEVGDIVVETVPIRTVNRQCSSGLQAVA DVAAAIKAGFYEIGIGAGLESMTLNQVAWDSTVNPKAQTLQKAQDCLLPMGITSENVAQRYGVTRQEQDQAAVDSHRKAAAATASGKFKDEIIPVATKLVDPKTGDEK | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 24,201.091 | ||
Theoretical pI: | 5.476 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 34.221 | ||
aromaticity | 0.044 | ||
GRAVY | -0.123 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.211 | ||
sheet | 0.259 |