Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647959.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
TGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGENDLPGLTDT EKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKCSKAPKIQRLVTPLTLQRKRSRIAEKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAAASKSSSV A | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 27,434.623 | ||
Theoretical pI: | 10.636 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
Instability index: | 43.082 | ||
aromaticity | 0.054 | ||
GRAVY | -0.885 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.216 | ||
sheet | 0.220 |