Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647961.1	internal	118	1-354(+)
Amino Acid sequence :
RRRKPAHMLNPEEIEKYKTAIAKMKALDKDDPWNFMQQATIHCTYCNGAFDQVGFPETLLQVHGSWLFLPWHRYYLYFWERILGKLIGDDTFAIPYWNWDNPEGMRMPELYLDKMSPL
Physicochemical properties
Number of amino acids:		118
Molecular weight:		14,201.231
Theoretical pI:		6.461
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		43430 43555
Instability index:		56.796
aromaticity		0.161
GRAVY		-0.547
Secondary Structure Fraction
Helix		0.331
turn		0.186
sheet		0.271