Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647966.1 | internal | 258 | 3-776(+) |
Amino Acid sequence : | |||
FSSSSFCPSVSIPNPNDYSPLSLRATRSSSLPLIGFVRLACGLVSSVARFEKRRDLNHQEVSSIETLAQRIGKAVRRPGAGSKARVHADVNVVRPKEYWDYESLTVQWGEQDDYEVVRKV GRGKYSEVFEGIHCPSNERCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQQSKTPSLVFEYVNNTDFKVLYPRLTEYDTRYYIYELLKALEYCHSQGIMHRDVKPHNVMID HEQRKLRLIDWGLAEFYH | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 29,826.948 | ||
Theoretical pI: | 9.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36245 | ||
Instability index: | 46.653 | ||
aromaticity | 0.093 | ||
GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.225 | ||
sheet | 0.202 |