Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647974.1 | internal | 269 | 3-809(+) |
Amino Acid sequence : | |||
YLKLLLFTSALLFFISISSINAQSTSSRPRALVLQVLKDASTRQYYTRFVQRTPYAVIDVVVDLGGRYMWVDCEQGYNSTSYHPLRCGSAKCRLSNANGCGQCFSPPRPGCNNNTCGVGP DNSVTNFGSYGELAEDVVALQSTDGSNPLTVVSIPRFIFACAPTLILNGLVKGAVGMAGFGRTRISLPAQFSAAFSIPRKFAMCLSGSTNDEDRGVMFFGNGPYFLLPNKEDLSKALTFT PLLFNPVSTAVSYPLGEPSAEYFIGVKSI | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 29,061.938 | ||
Theoretical pI: | 8.721 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22390 | ||
Instability index: | 26.505 | ||
aromaticity | 0.112 | ||
GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.312 | ||
sheet | 0.216 |