Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647976.1 | internal | 221 | 1-663(+) |
Amino Acid sequence : | |||
EVKIVMDMAEEAIHAQERDPYTAFANRVRELNYGNSYFFRPIRISDLRKVDPRRACEYFNNCFKDPSIFTVVIVGNLDPAVSLPLILQYLGGIPKPADPVLHFNRDDLKGLPFTFPAKII REVVRSPMVEAQCSVQISFPVELRNDAMMEEIHFVGFLGKLLETKIMQVLRFKHGQIYSVGVSVFLGGNKPSRTGDVRGDINVNFFCDPDLSWKLVDLVLA | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 25,093.842 | ||
Theoretical pI: | 6.505 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
Instability index: | 28.982 | ||
aromaticity | 0.104 | ||
GRAVY | 0.002 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.226 | ||
sheet | 0.226 |