Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647979.1	internal	230	2-691(+)
Amino Acid sequence :
AEVCAQRSKPPSKPSLWQTLNGNAPIVIARGGFSGIFPDSSSIAYNLAVMTSLPDVVLWCDVQLTKDAVGLCLPFVTINNSTDIERVKTNGQKDYMINGVLTSGWFSVDYTLNDFQNVSV NQEILSRSNRFDGNGYPVLTVDDLVAQFQPPGLWLNIQHDLFYAQHNLSMRSFVLSVSRRVIVNYISSPEVGFLRSITTRFNRSVTKLVFRFLDADAIEPSTNQSYSSLL
Physicochemical properties
Number of amino acids:		230
Molecular weight:		25,608.745
Theoretical pI:		6.136
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		32430 32555
Instability index:		51.641
aromaticity		0.104
GRAVY		-0.013
Secondary Structure Fraction
Helix		0.361
turn		0.291
sheet		0.183