Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647988.1 | 3prime_partial | 256 | 76-843(+) |
Amino Acid sequence : | |||
MPVDGLSGAGQTVCVTGAGGFIASWIVKLLLEKGYTVKGTVRNPDDPKNNHLRELEGGKERLVLCKADLLDYESLREAISGCVGVFHTASPVTDDPEQMVEPAVKGTKYVINAAAEAGVR RVVFTSSIGAVTMDPNRGPDVVVDESCWSDLEFCKKTKNWYCYGKAVAEQAAWEEAKEKGVELVVVNPVLVMGPLLQSTVNASIVHLLKYLTGSAKTYANAVQAYVHVKDVAMAHIIVFE NPAASGRYLCAESVLH | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 23,112.142 | ||
Theoretical pI: | 11.566 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 53.787 | ||
aromaticity | 0.080 | ||
GRAVY | -0.324 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.209 | ||
sheet | 0.199 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647988.1 | 5prime_partial | 201 | 843-238(-) |
Amino Acid sequence : | |||
VKHALGAQIPAGGRRILEHNYVSHCHVLHVHVSLHRIRIRFGRSRQVLQEVNYASVHGGLQQWTHHQHWIHHHQLHPLLLGLLPRRLLRHRFPVTIPILGFLAEFKIAPAGLVNDDIGTT VRVHGDGADRRREHDATDSGFSRSVDNVFSSFHRRLHHLFRIVRHRRSRVENPNASADSFSKALVIKKISFAQHQSLFSAF* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 23,112.142 | ||
Theoretical pI: | 11.566 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 53.787 | ||
aromaticity | 0.080 | ||
GRAVY | -0.324 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.209 | ||
sheet | 0.199 |