Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648011.1	internal	281	2-844(+)
Amino Acid sequence :
WHGVRLVDVLKRCGIYSRRMGASLVCFEGAENLPGGGGSKYGTSVFREYAMDPSRDIILAYMQNGELLSPDHGFPVRIIIPGFIGGRMVKWLSRIIVTPQESQSHYHFKDNRVLPSHVDA ELANSEAWWYKPEYIINELNTNSVITTPSHDEILPINSATTQRPYTLRGYAYSGGGKKVTRVEVTMDGGDTWQVCELDHPEKPNKYGKYWCWCFWSLEVEVLDLLGAKEIAVRAWDQTLN TQPEKLIWNVMGMMNNCWFRVKMNVCKPHKGEIGLVFEHPT
Physicochemical properties
Number of amino acids:		281
Molecular weight:		13,955.056
Theoretical pI:		8.643
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		39.576
aromaticity		0.065
GRAVY		0.049
Secondary Structure Fraction
Helix		0.366
turn		0.228
sheet		0.252

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648011.1	5prime_partial	123	844-473(-)
Amino Acid sequence :
SRVFKNETDLSLVWLAHVHLHPEPAVVHHSHHIPDELLGLSVEGLVPCTNSNLFGTKEVEHLNFQGPEAPAPVLSILVWFLRVIQFTHLPRVASIHRYLHTCHLLSPTRICVAPQRVRPL RGR*
Physicochemical properties
Number of amino acids:		123
Molecular weight:		13,955.056
Theoretical pI:		8.643
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		39.576
aromaticity		0.065
GRAVY		0.049
Secondary Structure Fraction
Helix		0.366
turn		0.228
sheet		0.252