Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648019.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
DWESCLNNKVGFKGFAVPKESQDKVANFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKYLLQSGLQKYLDQQGFNIVGYGCTTCI GNSGEIDDSVGAAISENDIIAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVNIDFEKEPIGVGKDGKSVYFKDIWPSTEEIAEVVQSSVLSDMFKSTYRSITTGNPMWNELS VPANTLYS | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 12,946.009 | ||
Theoretical pI: | 8.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 56.064 | ||
aromaticity | 0.119 | ||
GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.271 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648019.1 | complete | 118 | 421-65(-) |
Amino Acid sequence : | |||
MMSFSEIAAPTESSISPELPMHVVQPYPTILKPCWSKYFCRPLCSRYFVTTPEPGARLVFIQGFTSRPNSHAFFATKAAPSITLGFEVLVQLVIAAITTLPCLSSAGCPWNEKFATLS* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,946.009 | ||
Theoretical pI: | 8.342 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 56.064 | ||
aromaticity | 0.119 | ||
GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.271 | ||
sheet | 0.254 |