Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648028.1 | 3prime_partial | 255 | 80-844(+) |
Amino Acid sequence : | |||
MASNGEGNAEFSFANGPAGTGWNGLAKIQTNRRHNGICHDDSTTPVKAQTIDELHSLQKKKSAPTTPIKDADGTFAIISEEERQMLQLQSISASLASLTRETGPKLVRGDQARKVEAAKV SNVVDYTPAISVSDSSLKSTQVLHNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRSPRDKRVVRDETTEDELWWGKGSPNIEMDEHTFLVNRERAVDYLNSLDKVFVNDQFLNWD PEHRIKVRIVSARAY | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 28,117.028 | ||
Theoretical pI: | 6.327 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 32.015 | ||
aromaticity | 0.063 | ||
GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.247 | ||
sheet | 0.247 |