Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648030.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
SEQGDRYQELANRVDEALGFMAAAGLTIDHPIMTTTEFWTSHECLHLPYEQALTRKDSTSGLYYDCSAHMLWVGERTRQLDGAHVEFLKGVANPLGIKVSDKMNPSELVNLIEILNPKNK PGRITIITRMGAENMRVKLPHLIRAVRGAGQIVTWISDPMHGNAIKAPCGRKTRPFDAILAEVRAFFDVHEQEGSHPGGVHLEMTGQNVTECIGGSRTITYDDLSSNYNTHCDPRLNASQ SLELAFIVAERLRKR | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 11,018.215 | ||
Theoretical pI: | 10.786 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 49.201 | ||
aromaticity | 0.089 | ||
GRAVY | 0.703 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.287 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648030.1 | complete | 101 | 496-191(-) |
Amino Acid sequence : | |||
MALPCMGSLIHVTICPAPRTALIRCGSFTLMFSAPILVIIVILPGLFLGFKISMRFTSSLGFILSLTLMPRGLATPFKNSTWAPSNCRVRSPTQSMWAEQS* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,018.215 | ||
Theoretical pI: | 10.786 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 49.201 | ||
aromaticity | 0.089 | ||
GRAVY | 0.703 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.287 | ||
sheet | 0.267 |