Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648044.1	internal	266	3-800(+)
Amino Acid sequence :
DKPKIPLPQWVSHVGQAQPDVFLADRSGRHYTRCLSLAVDELPVLNGKTPMQVYQDFLESFNSSFSDLMGSTITDISIGLGPDGELRYPSYPPKRSNPISGVGEFQCYDKHLLRSLRLHA QAIGNVNWGLSGPHDAPTYYESPSSNGFFREDGGSWETPYGNFFLSWYADQLINHGDRLLSMASRIYTEFPVTLCAKVPLVHGWYKMRSHPSEMTAGFYNTSTRDGYDAVANMFSRNSCA MILPGMDLTDKHQPQDSLSSPELLLL
Physicochemical properties
Number of amino acids:		266
Molecular weight:		29,764.123
Theoretical pI:		5.673
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		46870 47120
Instability index:		43.489
aromaticity		0.113
GRAVY		-0.397
Secondary Structure Fraction
Helix		0.297
turn		0.308
sheet		0.222