Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648049.1 | internal | 269 | 1-807(+) |
Amino Acid sequence : | |||
DYLLNFSLMERMALPQGPNHRGEVQIYENSDDLSTQLADYIADLSEISVKERGFFAIALSGGSLISLMGKLCEAPYNKTVDWAKWYIFWVDERVVAKNHADSNYKLAKDGLLSRLPVVPS HVYSINDSMSAEEAANDYEFVLRQLVKTRIVGVSETSDCPKFDLILLGLGPDGHIASLFPDHAALEEKNDWVTFITDSPKPPPERITFTLPVINSASNVAVVVTGGGKADAVHLAIDNLE SYQSPLVPAQLVQPSNGRLVWFLDKAAAS | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 29,579.173 | ||
Theoretical pI: | 4.824 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
Instability index: | 34.408 | ||
aromaticity | 0.089 | ||
GRAVY | -0.063 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.253 | ||
sheet | 0.275 |