Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648055.1 | 3prime_partial | 161 | 70-552(+) |
Amino Acid sequence : | |||
MSFRSIVRDVRDGFGSLSRRSFEVRLTGHNRGKSQSAVHELQDQPLVIQNSCWASLPPELLRDVIRRLEESESTWPSRKNVVACAEVCRSWRDMCKEMVQSPEFCGKLTFPVSLKQPGPR DGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRN | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 18,397.031 | ||
Theoretical pI: | 9.393 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
Instability index: | 71.407 | ||
aromaticity | 0.075 | ||
GRAVY | -0.394 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.255 | ||
sheet | 0.230 |