Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648066.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
WFPHTLAMASRKVLSSLLRSSLRRLAAKPSIINPRTHVSRPSSKGFILNRVADYATSAAAASSAPAPPSTQGTGGPSGKITDEFTGAGAIGQVCQVIGAVVDVRFDEGLPPILTALEVLD NQIRLVLEVAQHLGENMVRTIAMDGTEGLVRGQRVLNTGSPITVPVGRATLGRIMNVIGEPIDEKGDIKTDHFLPIHREAPAFVEQATDKQILVTGIKVVDLLAPYQRGGKIGLFGGAGV GKTVLIMELINNV | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 26,721.603 | ||
Theoretical pI: | 9.370 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 30.096 | ||
aromaticity | 0.040 | ||
GRAVY | 0.117 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.261 | ||
sheet | 0.253 |