Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648075.1 | internal | 269 | 3-809(+) |
Amino Acid sequence : | |||
WRFDSSVNMSSVTVNFLDPPDDCFMKAFLSCPRDACVMSTISPTWRSMADSDDVWEHFLPSDYEEILARSVFPVSYSSKKDLFFRLCDSIPIDGGSKIFSLDRHTGKKCFLLGARELVVV WGDDDRYWRWGSDPRSRFSEVAMLNYVWWLEVKGIMDTSMLSSRTTYGAYLVMSYKPSFYGLDERPAEVSVEVGSSNKASRSMAQLSREARRGPRWEDEGMPFEPSITHGVVNLLQDRAD GWMEMELGEFYNFDGKDGEVRMSMMEVNG | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 12,797.989 | ||
Theoretical pI: | 8.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
Instability index: | 78.026 | ||
aromaticity | 0.090 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.225 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648075.1 | 5prime_partial | 111 | 810-475(-) |
Amino Acid sequence : | |||
VHSLPSYSSSLLHPFHQNCKTPPIPSPSSHLLCLVANLQRHGLWMAQMAFLHLPNVDHAWPPEIIEPCFLMPCYCFQLQHLPQLVVHRAHKMKAYMTLQDKHHKSFLKTAC* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,797.989 | ||
Theoretical pI: | 8.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
Instability index: | 78.026 | ||
aromaticity | 0.090 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.225 | ||
sheet | 0.270 |