Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648084.1 | internal | 283 | 2-850(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNA | |||
Physicochemical properties | |||
Number of amino acids: | 283 | ||
Molecular weight: | 30,869.770 | ||
Theoretical pI: | 7.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 47.893 | ||
aromaticity | 0.095 | ||
GRAVY | -0.025 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.307 | ||
sheet | 0.216 |