Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648098.1 | internal | 260 | 1-780(+) |
Amino Acid sequence : | |||
GAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAI AAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVS ESGWPSAGGTATSIDNARTY | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 28,555.976 | ||
Theoretical pI: | 7.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33350 33350 | ||
Instability index: | 46.791 | ||
aromaticity | 0.100 | ||
GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.315 | ||
sheet | 0.192 |