Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648118.1 | 5prime_partial | 243 | 2-733(+) |
Amino Acid sequence : | |||
LIVAINAKKNGKAVIVGGGYIGLELGAVMKLNNFDVTMVYPEPWCMPRLFTSGIAAFYEGYYANKGIKIVKGTVAVGFDSNADGEVRAVKLKDGRVLGADIVVVGVGGRPLTTLFKGQVE EEKGGIKTDSFFKTSVPDVYAIGDVATFPLKLYGEQRRVEHVDHARKSAEQAVKAIKASEEGRVIDEYDYLPYFYSRSFNLSWQFYGDNVGDTVLFGDNNPASENPKFGSYWIKEGKVVG VFP* | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 26,587.995 | ||
Theoretical pI: | 6.951 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35870 | ||
Instability index: | 23.676 | ||
aromaticity | 0.123 | ||
GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.251 | ||
sheet | 0.210 |