Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648119.1	internal	141	2-424(+)
Amino Acid sequence :
NDLAKNAALDLYPAHLQAKIDEFNEWVYSDINNGVYKCGFARKQEPYEQATEKLYQALDKCEDILSKQRYICGNSLTEADIRLFVTLIRFDEVYAVHFKCNKRLLREYPNLFNYTKDIYQ IPGMSGTVNMEHIKKHYYGSH
Physicochemical properties
Number of amino acids:		141
Molecular weight:		16,584.623
Theoretical pI:		6.569
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23380 23630
Instability index:		31.837
aromaticity		0.135
GRAVY		-0.577
Secondary Structure Fraction
Helix		0.333
turn		0.177
sheet		0.248