Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648119.1 | internal | 141 | 2-424(+) |
Amino Acid sequence : | |||
NDLAKNAALDLYPAHLQAKIDEFNEWVYSDINNGVYKCGFARKQEPYEQATEKLYQALDKCEDILSKQRYICGNSLTEADIRLFVTLIRFDEVYAVHFKCNKRLLREYPNLFNYTKDIYQ IPGMSGTVNMEHIKKHYYGSH | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 16,584.623 | ||
Theoretical pI: | 6.569 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23630 | ||
Instability index: | 31.837 | ||
aromaticity | 0.135 | ||
GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.177 | ||
sheet | 0.248 |