Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648122.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
RLAPGWYTEQGIELILSTEIVKVDLASKSLVSAAGLTFKYDTLLIATGSTVIRLTDFGVQGADAKNIFYLREIDDADKLIAAINAKKNGKAVIVGGGYIGLELGAVMKLNNFDVTMVYPE PWCMPRLFTSGIAAFYEGYYANKGIKIVKGTVAVGFDSNEDGEVRAVKLKDGRVLDADIVVVGVGGRPLTTLFKGQVEEEKGGIKTDSFFKTSVPDVYAIGDVATFPLKLYGEQRRVEHV DHARKSAEQAVKAIKASE | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 12,253.103 | ||
Theoretical pI: | 9.162 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 40.892 | ||
aromaticity | 0.076 | ||
GRAVY | 0.541 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.339 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648122.1 | 5prime_partial | 118 | 773-417(-) |
Amino Acid sequence : | |||
SLALIAFTACSADFRAWSTCSTLLCSPYNFSGKVATSPIAYTSGTLVLKKLSVLIPPFSSSTCPLNNVVRGLPPTPTTTISASRTLPSFSFTALTSPSSLESNPTATVPLTILIPLLA* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,253.103 | ||
Theoretical pI: | 9.162 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 40.892 | ||
aromaticity | 0.076 | ||
GRAVY | 0.541 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.339 | ||
sheet | 0.246 |