Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648154.1 | internal | 268 | 3-806(+) |
Amino Acid sequence : | |||
TFFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIA VGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVY RNLFDALVDSVYASLEKAGGGGLEIVVS | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 29,515.434 | ||
Theoretical pI: | 8.941 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.714 | ||
aromaticity | 0.101 | ||
GRAVY | 0.012 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.295 | ||
sheet | 0.213 |