Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648180.1	5prime_partial	225	1-678(+)
Amino Acid sequence :
ETWGFFQVVSHGIPSELLDEMLERVRMFNELPKEQRSKFYTMDGTRMVQYNSNFDLYRTKAAYWRDTICFKVAPDSPDPMEMPMQFRDILPRYSKHVMNLGKTLLELLSEALGVEKEHLN NTGCLNVVYIACHYYPPCPQPELTIGTPKHSDKDFLTVLQQDQIGGLQVLHQGQWLDIPPMDGALIINVGDLLQVLSNDKFKSSEHRVLANRVGPRISIASFFAK*
Physicochemical properties
Number of amino acids:		225
Molecular weight:		25,820.424
Theoretical pI:		5.983
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		28420 28670
Instability index:		29.740
aromaticity		0.098
GRAVY		-0.304
Secondary Structure Fraction
Helix		0.324
turn		0.227
sheet		0.249