Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648182.1 | internal | 223 | 1-669(+) |
Amino Acid sequence : | |||
RFSLLLLLPLVSCFVNKMEDECDYLFKAVLIGDSAVGKSNLLSRFARDEFRLDSKPTIGVEFAYRNVKVKDKLIKAQIWDTAGQERFRAITSSYYRGALGAMLVYDITRRATFENVPKWM EELRHFGDSDMVIILCGNKSDLGAQNRQVEEEEGRTLAEKERICFMETSALKNLNVEEAFLQMITQIHDITSKKNLEAKTVADDAIAPSAGKIIFNGSIDEVS | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 25,201.626 | ||
Theoretical pI: | 5.424 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 35.144 | ||
aromaticity | 0.085 | ||
GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.184 | ||
sheet | 0.296 |