Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648185.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
LHRRLKSSTMSRGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPVGFMDIVSIPKTNENFRLLYDTKGRFRL HSIKDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIRANDTIKLDLETNKIADFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGTFETIHIQDATGHEFATRLGNVFTIGKG TKP | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 11,326.050 | ||
Theoretical pI: | 6.182 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 40.681 | ||
aromaticity | 0.019 | ||
GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.302 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648185.1 | 5prime_partial | 106 | 730-410(-) |
Amino Acid sequence : | |||
RLCSLANGEDIAEASGKLMSCGILNVDGLKSALMLLPVLDHSNSSPVPPSSHHDDVTHIKLNEIGDLIGLKVKFDGIIGPDKRIRVANCPPIISVNVWDSLLAKLH* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,326.050 | ||
Theoretical pI: | 6.182 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 40.681 | ||
aromaticity | 0.019 | ||
GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.302 | ||
sheet | 0.245 |