Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648209.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
QPPPCFEELELKVKGSIQILGGQVFPKLNWSAPKDSAWISTTGMLQCTSFSEIALLLRSSESLVHDLCHAYDSCIDKTSSRPTKFYLALRKWYPSLRPEMEFRCFVQKNHLMAISQREVT GFYPALVEKKDGLEMSIREFFEENVKERFESDNYTFDVYVTRDGRVKLMDFNPWGAFTLPLLFTWDELEENFEKEGVDSVTFRIVDSQCAVRPGLKTAVPYDYLDTSPGSGWDQFLSKAD EELQ | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 12,374.501 | ||
Theoretical pI: | 8.732 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 53.960 | ||
aromaticity | 0.074 | ||
GRAVY | 0.231 | ||
Secondary Structure Fraction | |||
Helix | 0.389 | ||
turn | 0.241 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648209.1 | 5prime_partial | 108 | 732-406(-) |
Amino Acid sequence : | |||
LQLLICLTQELIPPTAWACVQIIIRNCSFQPWSNCTLAINNSKSNTIHAFLLKVLFQLIPSKQQWQCEGTPRIEIHKLNPPISSNINIKSVIVRLKSFLHILLEEFPD* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,374.501 | ||
Theoretical pI: | 8.732 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 53.960 | ||
aromaticity | 0.074 | ||
GRAVY | 0.231 | ||
Secondary Structure Fraction | |||
Helix | 0.389 | ||
turn | 0.241 | ||
sheet | 0.222 |