Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648210.1 | internal | 102 | 1-306(+) |
Amino Acid sequence : | |||
SHNGGGGGAFGSIVSLSGVLNFVDGLWSSCGGEKLIIFTTNHKEKLDQALLRPGRMDKHINLSYCEISAFRMLAKNYLNIENHKLMREVEELLPLVKMTPAD | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,244.874 | ||
Theoretical pI: | 6.874 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 45.315 | ||
aromaticity | 0.069 | ||
GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.284 | ||
sheet | 0.294 |