Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648241.1 | 5prime_partial | 171 | 2-517(+) |
Amino Acid sequence : | |||
ESVAQALFDLENTSNELKSELKDLYINSAVQVDVSGNRKAVVIHVPYRLRKSFRKIHVRLVRELEKKFSGKDVIMIATRRILRPPKKGSAVQRPRSRTLTAVHDAMLEDVVYPAEIVGKR IKYRIDGSKIMKVFLDPKERNNTEYKLETFSGVYRKLSGKDVVFEYPVTEP* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,704.660 | ||
Theoretical pI: | 9.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
Instability index: | 27.420 | ||
aromaticity | 0.076 | ||
GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.193 | ||
sheet | 0.228 |