Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648243.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
VATVQVVTLNSGHKMPVLGTGTASFPVPPLEELKKVIMEAMEVGYRHFDTAAMYQSEEGLGAAIKEALEKGLIKSRDELFITTKLWCNNAQPHLVLPAIRESLRRLRLEYVDLYLIHYPV RLKEDLLSMDCKEDEIFPID | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,869.310 | ||
Theoretical pI: | 5.399 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 51.154 | ||
aromaticity | 0.071 | ||
GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.171 | ||
sheet | 0.343 |