Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648258.1 | internal | 165 | 1-495(+) |
Amino Acid sequence : | |||
FLLFLLKPSHKNLPPGPFSWPLIGTLLPKLKKQPHLELSKLAQTYGPLMLLKFGVEPVVVASTHEAAMEVLKIHDRVLSGRFAPHSVRIKGYFEHSMVWADCTEYWKMVRKIWRTELFST KMLEAQASVREEKVKELMGFLRRKEGEAVKFADLIFGCILNILGS | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,904.288 | ||
Theoretical pI: | 9.597 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 31.985 | ||
aromaticity | 0.103 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.194 | ||
sheet | 0.321 |