Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648267.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
AVLDDFGLEAMLDKLMDDFVRPISRVFFSEFGGATLDSHHGFVVEYGKDRDVDLGFHVDDSEVTLNVCLGKQFSGGELFFRGIRCDKHVNTETQPEEILDYSHVPGQAVLHRGRHRHGAR ATTSGHRINLLLWCRSSAFRELKKYQKDFSSWCGECQREKKE | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,534.611 | ||
Theoretical pI: | 6.145 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 28.442 | ||
aromaticity | 0.105 | ||
GRAVY | -0.512 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.198 | ||
sheet | 0.222 |