Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648273.1 | internal | 131 | 3-395(+) |
Amino Acid sequence : | |||
ALVSTLSSTNTTTEASFKNEIVARKSANFPPSVWGDCFLEYKFDLEEFNTSTQEVETLKEEVRKSLKAAKYEPSELIKLIDALQRLGVAYHFEREVEKALKQLHDIAYSFIVNNDDLYAC ALFFRLLRQGG | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,960.757 | ||
Theoretical pI: | 5.245 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 32.815 | ||
aromaticity | 0.115 | ||
GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.176 | ||
sheet | 0.321 |